SCOP 1.75: Domain d2zkdb1: 2zkd B:405-612

Lineage for d2zkdb1 (2zkd B:405-612)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.12: SRA domain-like [159368] (1 protein)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [159371] (6 PDB entries)
   Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625

8. Domain d2zkdb1: 2zkd B:405-612 [154584]
   automatically matched to 2ZKD A:405-613
   complexed with 5cm, act, edo

Details for d2zkdb1

PDB Entry: 2zkd, 1.6 Å

PDB Description: crystal structure of the sra domain of mouse np95 in complex with hemi-methylated cpg dna

PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOP Domain Sequences for d2zkdb1:

Sequence; same for both SEQRES and ATOM records:

>d2zkdb1 b.122.1.12 (B:405-612) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
gmacvgrttectivpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgays
lvlaggyeddvdngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinek
gaeaedwrqgkpvrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryll
rrddtepepwtregkdrtrqlgltmqyp

Timeline for d2zkdb1:

• d2zkdb1 is new in SCOP 1.75
  
• d2zkdb1 is called d2zkdb_ in SCOPe 2.01
  
• d2zkdb1 appears in the current release, SCOPe 2.08, called d2zkdb_