SCOPe 2.03: Domain d1c7dd_: 1c7d D:

Lineage for d1c7dd_ (1c7d D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (207 PDB entries)
   Uniprot P68871

8. Domain d1c7dd_: 1c7d D: [15458]
   Other proteins in same PDB: d1c7da1, d1c7da2
   recombinant hemoglobin rhb1.2
   complexed with hem

Details for d1c7dd_

PDB Entry: 1c7d, 1.8 Å

PDB Description: deoxy rhb1.2 (recombinant hemoglobin)

PDB Compounds: (D:) protein (deoxyhemoglobin (beta chain))

SCOPe Domain Sequences for d1c7dd_:

Sequence; same for both SEQRES and ATOM records:

>d1c7dd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1c7dd_:

• d1c7dd_ first appeared (with stable ids) in SCOP 1.55
  
• d1c7dd_ appears in SCOPe 2.02
  
• d1c7dd_ appears in SCOPe 2.04
  
• d1c7dd_ appears in the current release, SCOPe 2.08