Lineage for d2zjrg1 (2zjr G:30-171)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837505Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 1837506Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 1837507Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 1837508Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 1837509Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
    Uniprot Q9RXY1 30-171
  8. 1837510Domain d2zjrg1: 2zjr G:30-171 [154560]
    Other proteins in same PDB: d2zjr11, d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
    Representative structure
    complexed with mg

Details for d2zjrg1

PDB Entry: 2zjr (more details), 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans
PDB Compounds: (G:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2zjrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjrg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

SCOPe Domain Coordinates for d2zjrg1:

Click to download the PDB-style file with coordinates for d2zjrg1.
(The format of our PDB-style files is described here.)

Timeline for d2zjrg1: