SCOPe 2.05: Domain d2zjr11: 2zjr 1:2-54

Lineage for d2zjr11 (2zjr 1:2-54)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries)
   Uniprot Q9RSS4 2-54

8. Domain d2zjr11: 2zjr 1:2-54 [154549]
   Other proteins in same PDB: d2zjr21, d2zjr31, d2zjr41, d2zjra1, d2zjra2, d2zjrb1, d2zjrc1, d2zjrd1, d2zjre1, d2zjre2, d2zjrg1, d2zjrh1, d2zjri1, d2zjrj1, d2zjrk1, d2zjrl1, d2zjrm1, d2zjrn1, d2zjro1, d2zjrp1, d2zjrq1, d2zjrr1, d2zjrs1, d2zjrt1, d2zjru1, d2zjrv1, d2zjrw1, d2zjrz1
   Representative structure
   complexed with mg

Details for d2zjr11

PDB Entry: 2zjr, 2.91 Å

PDB Description: Refined native structure of the large ribosomal subunit (50S) from Deinococcus radiodurans

PDB Compounds: (1:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2zjr11:

Sequence; same for both SEQRES and ATOM records:

>d2zjr11 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

Timeline for d2zjr11:

• d2zjr11 first appeared in SCOP 1.75
  
• d2zjr11 appears in SCOPe 2.04
  
• d2zjr11 appears in SCOPe 2.06
  
• d2zjr11 appears in the current release, SCOPe 2.08