SCOPe 2.03: Domain d2zjqo1: 2zjq O:5-98

Lineage for d2zjqo1 (2zjq O:5-98)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
   Uniprot Q9RY64 5-98

8. Domain d2zjqo1: 2zjq O:5-98 [154539]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR O:5-98
   protein/RNA complex

Details for d2zjqo1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (O:) 50S ribosomal protein L21

SCOPe Domain Sequences for d2zjqo1:

Sequence; same for both SEQRES and ATOM records:

>d2zjqo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

Timeline for d2zjqo1:

• d2zjqo1 first appeared in SCOP 1.75
  
• d2zjqo1 appears in SCOPe 2.02
  
• d2zjqo1 appears in SCOPe 2.04
  
• d2zjqo1 appears in the current release, SCOPe 2.08