SCOPe 2.05: Domain d2zjqf2: 2zjq F:1-71

Lineage for d2zjqf2 (2zjq F:1-71)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160199] (4 PDB entries)
   Uniprot Q9RSS7 1-71

8. Domain d2zjqf2: 2zjq F:1-71 [154530]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   Representative structure
   protein/RNA complex

Details for d2zjqf2

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2zjqf2:

Sequence; same for both SEQRES and ATOM records:

>d2zjqf2 d.47.1.1 (F:1-71) Ribosomal protein L11, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitkt

Timeline for d2zjqf2:

• d2zjqf2 first appeared in SCOP 1.75
  
• d2zjqf2 appears in SCOPe 2.04
  
• d2zjqf2 appears in SCOPe 2.06
  
• d2zjqf2 appears in the current release, SCOPe 2.08