Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) |
Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [160199] (4 PDB entries) Uniprot Q9RSS7 1-71 |
Domain d2zjqf2: 2zjq F:1-71 [154530] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 Representative structure protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjqf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqf2 d.47.1.1 (F:1-71) Ribosomal protein L11, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy adrsftfitkt
Timeline for d2zjqf2:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |