Lineage for d2zjqa2 (2zjq A:33-127)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789194Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 1789198Species Deinococcus radiodurans [TaxId:1299] [159085] (5 PDB entries)
    Uniprot Q9RXJ9 33-127
  8. 1789201Domain d2zjqa2: 2zjq A:33-127 [154523]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR A:33-127
    protein/RNA complex

Details for d2zjqa2

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2zjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqa2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
ltealpktggrnnrgritsrfiggghkrlyriidfkrrdksgvnakvaaieydpnrsari
allhyadgekryilapegltvgatvnagpeaepkl

SCOPe Domain Coordinates for d2zjqa2:

Click to download the PDB-style file with coordinates for d2zjqa2.
(The format of our PDB-style files is described here.)

Timeline for d2zjqa2: