Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
Superfamily d.301.1: L35p-like [143034] (1 family) automatically mapped to Pfam PF01632 |
Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
Protein Ribosomal protein L35p [143036] (3 species) |
Domain d2zjq31: 2zjq 3:2-64 [154519] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR 3:2-64 protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjq31:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjq31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d2zjq31:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |