Lineage for d2zjpy1 (2zjp Y:2-59)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3037149Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 3037150Protein Ribosomal protein L32p [144201] (3 species)
  7. 3037151Species Deinococcus radiodurans [TaxId:1299] [161178] (6 PDB entries)
    Uniprot P49228 2-59
  8. 3037155Domain d2zjpy1: 2zjp Y:2-59 [154516]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1
    automatically matched to 2ZJR Z:2-59
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpy1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (Y:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2zjpy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpy1 g.41.8.5 (Y:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d2zjpy1:

Click to download the PDB-style file with coordinates for d2zjpy1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpy1: