Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
Protein Ribosomal protein L23 [54191] (4 species) |
Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries) Uniprot Q9RXK0 2-94 |
Domain d2zjpq1: 2zjp Q:2-94 [154509] Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 automatically matched to 2ZJR Q:2-94 protein/RNA complex; complexed with mg, no1, zn |
PDB Entry: 2zjp (more details), 3.7 Å
SCOPe Domain Sequences for d2zjpq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjpq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk rkrvgrfigqrndrkkaivrlaegqsiealagq
Timeline for d2zjpq1:
View in 3D Domains from other chains: (mouse over for more information) d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1 |