SCOPe 2.01: Domain d2zjpp1: 2zjp P:8-134

Lineage for d2zjpp1 (2zjp P:8-134)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries)
   Uniprot Q9RXJ7 8-134

8. Domain d2zjpp1: 2zjp P:8-134 [154508]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR P:8-134
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpp1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (P:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2zjpp1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep
vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii
vaekgnk

Timeline for d2zjpp1:

• d2zjpp1 first appeared in SCOP 1.75
  
• d2zjpp1 appears in SCOPe 2.02
  
• d2zjpp1 appears in the current release, SCOPe 2.08