Lineage for d2zjph1 (2zjp H:1-134)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123581Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 1123582Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 1123583Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 1123584Protein Ribosomal protein L14 [50195] (5 species)
  7. 1123587Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
    Uniprot Q9RXJ2 1-134
  8. 1123591Domain d2zjph1: 2zjp H:1-134 [154500]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR H:1-134
    protein/RNA complex; complexed with mg, no1, zn

Details for d2zjph1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (H:) 50S ribosomal protein L14

SCOPe Domain Sequences for d2zjph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjph1 b.39.1.1 (H:1-134) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
rrfmkivslapevl

SCOPe Domain Coordinates for d2zjph1:

Click to download the PDB-style file with coordinates for d2zjph1.
(The format of our PDB-style files is described here.)

Timeline for d2zjph1: