Lineage for d2zjpc1 (2zjp C:2-198)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825407Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 825408Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 825409Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 825410Protein Ribosomal protein L4 [52168] (5 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 825458Species Deinococcus radiodurans [TaxId:1299] [159478] (6 PDB entries)
    Uniprot Q9RXK1 2-198
  8. 825463Domain d2zjpc1: 2zjp C:2-198 [154493]
    Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
    automatically matched to 2ZJR C:2-198
    complexed with mg, nsh, zn

Details for d2zjpc1

PDB Entry: 2zjp (more details), 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (C:) 50S ribosomal protein L4

SCOP Domain Sequences for d2zjpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjpc1 c.22.1.1 (C:2-198) Ribosomal protein L4 {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOP Domain Coordinates for d2zjpc1:

Click to download the PDB-style file with coordinates for d2zjpc1.
(The format of our PDB-style files is described here.)

Timeline for d2zjpc1: