SCOPe 2.08: Domain d2zjpa1: 2zjp A:128-272

Lineage for d2zjpa1 (2zjp A:128-272)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159028] (5 PDB entries)
   Uniprot Q9RXJ9 128-272

8. Domain d2zjpa1: 2zjp A:128-272 [154490]
   Other proteins in same PDB: d2zjp11, d2zjp21, d2zjp31, d2zjp41, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR A:128-272
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjpa1

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2zjpa1:

Sequence; same for both SEQRES and ATOM records:

>d2zjpa1 b.34.5.3 (A:128-272) C-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
gnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelrrvhs
ecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgagrvpv
tpwgkptkglktrrkrktsdrfivt

Timeline for d2zjpa1:

• d2zjpa1 first appeared in SCOP 1.75
  
• d2zjpa1 appears in SCOPe 2.07