SCOPe 2.08: Domain d2zjp11: 2zjp 1:2-54

Lineage for d2zjp11 (2zjp 1:2-54)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries)
   Uniprot Q9RSS4 2-54

8. Domain d2zjp11: 2zjp 1:2-54 [154486]
   Other proteins in same PDB: d2zjp21, d2zjp31, d2zjp41, d2zjpa1, d2zjpa2, d2zjpb1, d2zjpc1, d2zjpd1, d2zjpe1, d2zjpe2, d2zjpf1, d2zjpf2, d2zjpg1, d2zjph1, d2zjpi1, d2zjpj1, d2zjpk1, d2zjpl1, d2zjpm1, d2zjpn1, d2zjpo1, d2zjpp1, d2zjpq1, d2zjpr1, d2zjps1, d2zjpt1, d2zjpu1, d2zjpv1, d2zjpw1, d2zjpy1
   automatically matched to 2ZJR 1:2-54
   protein/RNA complex; complexed with mg, no1, zn

Details for d2zjp11

PDB Entry: 2zjp, 3.7 Å

PDB Description: thiopeptide antibiotic nosiheptide bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (1:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2zjp11:

Sequence; same for both SEQRES and ATOM records:

>d2zjp11 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

Timeline for d2zjp11:

• d2zjp11 first appeared in SCOP 1.75
  
• d2zjp11 appears in SCOPe 2.07