Lineage for d2zitf_ (2zit F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681421Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1681507Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1681508Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 1681526Domain d2zitf_: 2zit F: [154483]
    Other proteins in same PDB: d2zita1, d2zita2, d2zita3, d2zita4, d2zita5, d2zitc1, d2zitc2, d2zitc3, d2zitc4, d2zitc5, d2zite1, d2zite2, d2zite3, d2zite4, d2zite5
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d2zitf_

PDB Entry: 2zit (more details), 3 Å

PDB Description: structure of the eef2-exoa-nad+ complex
PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d2zitf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zitf_ d.166.1.1 (F:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d2zitf_:

Click to download the PDB-style file with coordinates for d2zitf_.
(The format of our PDB-style files is described here.)

Timeline for d2zitf_: