Lineage for d2zhba1 (2zhb A:143-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735618Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2735619Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2735701Family a.160.1.0: automated matches [227288] (1 protein)
    not a true family
  6. 2735702Protein automated matches [227106] (2 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:2234] [255726] (2 PDB entries)
  8. 2735704Domain d2zhba1: 2zhb A:143-257 [154463]
    Other proteins in same PDB: d2zhba2, d2zhba3
    automated match to d1r89a1
    protein/RNA complex; complexed with so4

Details for d2zhba1

PDB Entry: 2zhb (more details), 3.05 Å

PDB Description: Complex structure of AFCCA with tRNAminiDUC
PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zhba1 a.160.1.0 (A:143-257) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
gkenevrllkgflkangiygaeykvrgfsgylcellivfygsfletvknarrwtrrtvid
vakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmeapslgffkpk

SCOPe Domain Coordinates for d2zhba1:

Click to download the PDB-style file with coordinates for d2zhba1.
(The format of our PDB-style files is described here.)

Timeline for d2zhba1: