SCOPe 2.04: Domain d2zh7a2: 2zh7 A:2-142

Lineage for d2zh7a2 (2zh7 A:2-142)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.0: automated matches [227287] (1 protein)
   not a true family

6. Protein automated matches [227105] (4 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [255725] (2 PDB entries)

8. Domain d2zh7a2: 2zh7 A:2-142 [154452]
   Other proteins in same PDB: d2zh7a1, d2zh7a3
   automated match to d1r89a2
   protein/RNA complex; complexed with so4

Details for d2zh7a2

PDB Entry: 2zh7, 3 Å

PDB Description: Complex structure of AFCCA with tRNAminiDG

PDB Compounds: (A:) CCA-adding enzyme

SCOPe Domain Sequences for d2zh7a2:

Sequence; same for both SEQRES and ATOM records:

>d2zh7a2 d.218.1.0 (A:2-142) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
vfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkepk
niksavdrtpfhhkwlegrik

Timeline for d2zh7a2:

• d2zh7a2 first appeared in SCOP 1.75
  
• d2zh7a2 appears in SCOPe 2.03
  
• d2zh7a2 appears in SCOPe 2.05
  
• d2zh7a2 appears in the current release, SCOPe 2.08