Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (18 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (95 PDB entries) |
Domain d1dxud_: 1dxu D: [15443] Other proteins in same PDB: d1dxua_, d1dxuc_ complexed with hem, so4; mutant |
PDB Entry: 1dxu (more details), 1.8 Å
SCOP Domain Sequences for d1dxud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)} mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1dxud_: