Lineage for d1c7cd_ (1c7c D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531179Domain d1c7cd_: 1c7c D: [15439]
    Other proteins in same PDB: d1c7ca1, d1c7ca2
    recombinant hemoglobin rhb1.1
    complexed with hem; mutant

Details for d1c7cd_

PDB Entry: 1c7c (more details), 1.8 Å

PDB Description: deoxy rhb1.1 (recombinant hemoglobin)

SCOP Domain Sequences for d1c7cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7cd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1c7cd_:

Click to download the PDB-style file with coordinates for d1c7cd_.
(The format of our PDB-style files is described here.)

Timeline for d1c7cd_: