SCOPe 2.01: Domain d2zcyw_: 2zcy W:

Lineage for d2zcyw_ (2zcy W:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2zcyw_: 2zcy W: [154375]
   Other proteins in same PDB: d2zcya_, d2zcyb_, d2zcyc_, d2zcye_, d2zcyf1, d2zcyg_, d2zcyh_, d2zcyl_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcys_, d2zcyt1, d2zcyu_, d2zcyv_, d2zcyz_
   automated match to d1g0ui_
   complexed with srg

Details for d2zcyw_

PDB Entry: 2zcy, 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex

PDB Compounds: (W:) Proteasome component PUP3

SCOPe Domain Sequences for d2zcyw_:

Sequence; same for both SEQRES and ATOM records:

>d2zcyw_ d.153.1.4 (W:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d2zcyw_:

• d2zcyw_ first appeared in SCOP 1.75, called d2zcyw1
  
• d2zcyw_ appears in SCOPe 2.02
  
• d2zcyw_ appears in the current release, SCOPe 2.08