Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries) |
Domain d2zcyv_: 2zcy V: [154374] Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcye_, d2zcyf_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym_, d2zcyn_, d2zcyo_, d2zcys_, d2zcyt_, d2zcyw_, d2zcyx_, d2zcyy_ automated match to d1g0uh_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOPe Domain Sequences for d2zcyv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcyv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d2zcyv_:
View in 3D Domains from other chains: (mouse over for more information) d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyf_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ |