Lineage for d2zcyt_ (2zcy T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2995929Domain d2zcyt_: 2zcy T: [154372]
    Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc2, d2zcyc3, d2zcyd_, d2zcye_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq2, d2zcyq3, d2zcyr_, d2zcys_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_
    automated match to d1irug_
    complexed with srg

Details for d2zcyt_

PDB Entry: 2zcy (more details), 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d2zcyt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcyt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d2zcyt_:

Click to download the PDB-style file with coordinates for d2zcyt_.
(The format of our PDB-style files is described here.)

Timeline for d2zcyt_: