Lineage for d2zcyi_ (2zcy I:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045454Domain d2zcyi_: 2zcy I: [154362]
    Other proteins in same PDB: d2zcya_, d2zcyb_, d2zcyc_, d2zcye_, d2zcyf1, d2zcyg_, d2zcyh_, d2zcyl_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcys_, d2zcyt1, d2zcyu_, d2zcyv_, d2zcyz_
    automated match to d1g0ui_
    complexed with srg

Details for d2zcyi_

PDB Entry: 2zcy (more details), 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex
PDB Compounds: (I:) Proteasome component PUP3

SCOPe Domain Sequences for d2zcyi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcyi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d2zcyi_:

Click to download the PDB-style file with coordinates for d2zcyi_.
(The format of our PDB-style files is described here.)

Timeline for d2zcyi_: