Lineage for d2zasa_ (2zas A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1281067Protein automated matches [190059] (12 species)
    not a true protein
  7. 1281087Species Human (Homo sapiens) [TaxId:9606] [187214] (121 PDB entries)
  8. 1281128Domain d2zasa_: 2zas A: [154285]
    automated match to d1tfca_
    protein/DNA complex; complexed with 1oh, gol

Details for d2zasa_

PDB Entry: 2zas (more details), 2 Å

PDB Description: crystal structure of human estrogen-related receptor gamma ligand binding domain complex with 4-alpha-cumylphenol, a bisphenol a derivative
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2zasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zasa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv

SCOPe Domain Coordinates for d2zasa_:

Click to download the PDB-style file with coordinates for d2zasa_.
(The format of our PDB-style files is described here.)

Timeline for d2zasa_: