Lineage for d2za6a1 (2za6 A:3-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766021Protein (Apo)ferritin [47246] (7 species)
  7. 766079Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (20 PDB entries)
  8. 766088Domain d2za6a1: 2za6 A:3-172 [154274]
    automatically matched to d1data_
    complexed with cd

Details for d2za6a1

PDB Entry: 2za6 (more details), 1.75 Å

PDB Description: recombinant horse L-chain apoferritin
PDB Compounds: (A:) ferritin light chain

SCOP Domain Sequences for d2za6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za6a1 a.25.1.1 (A:3-172) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOP Domain Coordinates for d2za6a1:

Click to download the PDB-style file with coordinates for d2za6a1.
(The format of our PDB-style files is described here.)

Timeline for d2za6a1: