Lineage for d2z93c1 (2z93 C:114-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515499Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1515902Domain d2z93c1: 2z93 C:114-212 [154229]
    Other proteins in same PDB: d2z93d1, d2z93d2
    automatically matched to d1fnsh2
    complexed with end

Details for d2z93c1

PDB Entry: 2z93 (more details), 2.4 Å

PDB Description: crystal structure of fab fragment of anti-ciguatoxin antibody 10c9 in complex with ctx3c-abcd
PDB Compounds: (C:) Anti-ciguatoxin antibody 10C9 Fab heavy chain

SCOPe Domain Sequences for d2z93c1:

Sequence, based on SEQRES records: (download)

>d2z93c1 b.1.1.2 (C:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d2z93c1 b.1.1.2 (C:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplaptlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
twpsetvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d2z93c1:

Click to download the PDB-style file with coordinates for d2z93c1.
(The format of our PDB-style files is described here.)

Timeline for d2z93c1: