Lineage for d2z7wb_ (2z7w B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 936787Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 936807Domain d2z7wb_: 2z7w B: [154203]
    automated match to d1cbja_
    complexed with cu, zn

Details for d2z7wb_

PDB Entry: 2z7w (more details), 1.8 Å

PDB Description: Crystal Structure of H2O2 treated Cu,Zn-SOD
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2z7wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7wb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOPe Domain Coordinates for d2z7wb_:

Click to download the PDB-style file with coordinates for d2z7wb_.
(The format of our PDB-style files is described here.)

Timeline for d2z7wb_: