Lineage for d2z7wa1 (2z7w A:1-151)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788402Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 788403Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 788416Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 788454Species Cow (Bos taurus) [TaxId:9913] [49332] (21 PDB entries)
  8. 788471Domain d2z7wa1: 2z7w A:1-151 [154202]
    automatically matched to d1cbja_
    complexed with cu, zn

Details for d2z7wa1

PDB Entry: 2z7w (more details), 1.8 Å

PDB Description: Crystal Structure of H2O2 treated Cu,Zn-SOD
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOP Domain Sequences for d2z7wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7wa1 b.1.8.1 (A:1-151) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d2z7wa1:

Click to download the PDB-style file with coordinates for d2z7wa1.
(The format of our PDB-style files is described here.)

Timeline for d2z7wa1: