Lineage for d2z6ta1 (2z6t A:1-151)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759674Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
    Uniprot P02185
  8. 759685Domain d2z6ta1: 2z6t A:1-151 [154183]
    automatically matched to d1ufpa_
    complexed with hem, per, so4

Details for d2z6ta1

PDB Entry: 2z6t (more details), 1.2 Å

PDB Description: Crystal structure of the ferric peroxo myoglobin
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2z6ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6ta1 a.1.1.2 (A:1-151) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy

SCOP Domain Coordinates for d2z6ta1:

Click to download the PDB-style file with coordinates for d2z6ta1.
(The format of our PDB-style files is described here.)

Timeline for d2z6ta1: