SCOP 1.75: Domain d2z6sa1: 2z6s A:1-152

Lineage for d2z6sa1 (2z6s A:1-152)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
   Uniprot P02185

8. Domain d2z6sa1: 2z6s A:1-152 [154182]
   automatically matched to d1ufpa_
   complexed with hem, oxy, so4

Details for d2z6sa1

PDB Entry: 2z6s, 1.25 Å

PDB Description: Crystal structure of the oxy myoglobin free from X-ray-induced photoreduction

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2z6sa1:

Sequence; same for both SEQRES and ATOM records:

>d2z6sa1 a.1.1.2 (A:1-152) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

Timeline for d2z6sa1:

• d2z6sa1 is new in SCOP 1.75
  
• d2z6sa1 is called d2z6sa_ in SCOPe 2.01
  
• d2z6sa1 appears in the current release, SCOPe 2.08, called d2z6sa_