Lineage for d2z68a1 (2z68 A:7-213)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777773Protein Heme oxygenase HmuO [89159] (1 species)
  7. 777774Species Corynebacterium diphtheriae [TaxId:1717] [89160] (10 PDB entries)
    Uniprot P71119
  8. 777783Domain d2z68a1: 2z68 A:7-213 [154174]
    automatically matched to d1iw1a_
    complexed with na, so4, til

Details for d2z68a1

PDB Entry: 2z68 (more details), 1.58 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Cr[N-salicylidene-4-amino-3-hydroxyhydrocinnamic acid]/Wild Type Heme oxygenase
PDB Compounds: (A:) Heme oxygenase

SCOP Domain Sequences for d2z68a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z68a1 a.132.1.1 (A:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d2z68a1:

Click to download the PDB-style file with coordinates for d2z68a1.
(The format of our PDB-style files is described here.)

Timeline for d2z68a1: