Lineage for d1gcwc_ (1gcw C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 131Species Houndshark (Mustelus griseus) [TaxId:89020] [46499] (2 PDB entries)
  8. 135Domain d1gcwc_: 1gcw C: [15413]
    Other proteins in same PDB: d1gcwb_, d1gcwd_

Details for d1gcwc_

PDB Entry: 1gcw (more details), 2 Å

PDB Description: CO form hemoglobin from mustelus griseus

SCOP Domain Sequences for d1gcwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcwc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus)}
aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
hcavdkllsaicqelssryr

SCOP Domain Coordinates for d1gcwc_:

Click to download the PDB-style file with coordinates for d1gcwc_.
(The format of our PDB-style files is described here.)

Timeline for d1gcwc_: