![]() | Class j: Peptides [58231] (133 folds) |
![]() | Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) ![]() |
![]() | Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
![]() | Protein Ribosomal protein S21, RpsU [161310] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
![]() | Domain d2z4mu1: 2z4m U:3-53 [154125] Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOPe Domain Sequences for d2z4mu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4mu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2z4mu1: