SCOPe 2.08: Domain d2z4mu1: 2z4m U:3-53

Lineage for d2z4mu1 (2z4m U:3-53)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2z4mu1: 2z4m U:3-53 [154125]
   Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1
   protein/RNA complex; complexed with mg, par
   protein/RNA complex; complexed with mg, par

Details for d2z4mu1

PDB Entry: 2z4m, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2z4mu1:

Sequence; same for both SEQRES and ATOM records:

>d2z4mu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2z4mu1:

• d2z4mu1 first appeared in SCOP 1.75
  
• d2z4mu1 appears in SCOPe 2.07