Lineage for d2z4ms1 (2z4m S:2-80)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200309Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1200310Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1200311Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1200312Protein Ribosomal protein S19 [54572] (2 species)
  7. 1200313Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1200336Domain d2z4ms1: 2z4m S:2-80 [154123]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4mt1, d2z4mu1
    automatically matched to 2AVY S:2-80
    protein/RNA complex; complexed with mg, par

Details for d2z4ms1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2z4ms1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4ms1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2z4ms1:

Click to download the PDB-style file with coordinates for d2z4ms1.
(The format of our PDB-style files is described here.)

Timeline for d2z4ms1: