Lineage for d2z4mq1 (2z4m Q:3-82)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800031Protein Ribosomal protein S17 [50304] (3 species)
  7. 800034Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 800057Domain d2z4mq1: 2z4m Q:3-82 [154121]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
    automatically matched to 2AVY Q:3-82
    complexed with mg, par

Details for d2z4mq1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d2z4mq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOP Domain Coordinates for d2z4mq1:

Click to download the PDB-style file with coordinates for d2z4mq1.
(The format of our PDB-style files is described here.)

Timeline for d2z4mq1: