SCOP 1.75: Domain d1gcwa_: 1gcw A:

Lineage for d1gcwa_ (1gcw A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Houndshark (Mustelus griseus) [TaxId:89020] [46499] (2 PDB entries)

8. Domain d1gcwa_: 1gcw A: [15412]
   Other proteins in same PDB: d1gcwb_, d1gcwd_

Details for d1gcwa_

PDB Entry: 1gcw, 2 Å

PDB Description: CO form hemoglobin from mustelus griseus

PDB Compounds: (A:) protein (hemoglobin)

SCOP Domain Sequences for d1gcwa_:

Sequence; same for both SEQRES and ATOM records:

>d1gcwa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
hcavdkllsaicqelssryr

Timeline for d1gcwa_:

• d1gcwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1gcwa_ appears in SCOP 1.73
  
• d1gcwa_ appears in SCOPe 2.01
  
• d1gcwa_ appears in the current release, SCOPe 2.08