Lineage for d2z4mm1 (2z4m M:1-113)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735303Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2735304Protein Ribosomal protein S13 [46948] (2 species)
  7. 2735305Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 2735329Domain d2z4mm1: 2z4m M:1-113 [154118]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
    protein/RNA complex; complexed with mg, par
    protein/RNA complex; complexed with mg, par

Details for d2z4mm1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2z4mm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mm1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk

SCOPe Domain Coordinates for d2z4mm1:

Click to download the PDB-style file with coordinates for d2z4mm1.
(The format of our PDB-style files is described here.)

Timeline for d2z4mm1: