Lineage for d2z4mj1 (2z4m J:5-102)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206381Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1206382Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1206383Protein Ribosomal protein S10 [55001] (2 species)
  7. 1206384Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 1206407Domain d2z4mj1: 2z4m J:5-102 [154115]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
    automatically matched to 2AVY J:5-102
    protein/RNA complex; complexed with mg, par

Details for d2z4mj1

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2z4mj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d2z4mj1:

Click to download the PDB-style file with coordinates for d2z4mj1.
(The format of our PDB-style files is described here.)

Timeline for d2z4mj1: