Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) |
Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
Protein Ribosomal protein S6 [54997] (4 species) |
Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
Domain d2z4mf1: 2z4m F:1-100 [154111] Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1 protein/RNA complex; complexed with mg, par protein/RNA complex; complexed with mg, par |
PDB Entry: 2z4m (more details), 4.45 Å
SCOPe Domain Sequences for d2z4mf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4mf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2z4mf1: