Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Houndshark (Mustelus griseus) [TaxId:89020] [46499] (2 PDB entries) |
Domain d1gcvc_: 1gcv C: [15411] Other proteins in same PDB: d1gcvb_, d1gcvd_ complexed with hem |
PDB Entry: 1gcv (more details), 2 Å
SCOP Domain Sequences for d1gcvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcvc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus)} aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt hcavdkllsaicqelssryr
Timeline for d1gcvc_: