SCOP 1.75: Domain d2z4md1: 2z4m D:1-205

Lineage for d2z4md1 (2z4m D:1-205)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
   Uniprot P0A7V8 1-205

8. Domain d2z4md1: 2z4m D:1-205 [154108]
   Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4mc2, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
   automatically matched to 2AVY D:1-205
   complexed with mg, par

Details for d2z4md1

PDB Entry: 2z4m, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d2z4md1:

Sequence; same for both SEQRES and ATOM records:

>d2z4md1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

Timeline for d2z4md1:

• d2z4md1 is new in SCOP 1.75
  
• d2z4md1 appears in SCOPe 2.01
  
• d2z4md1 appears in the current release, SCOPe 2.08