Lineage for d2z4mc2 (2z4m C:106-206)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648947Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1648948Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1648949Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1648950Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1648951Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 1648974Domain d2z4mc2: 2z4m C:106-206 [154107]
    Other proteins in same PDB: d2z4mb1, d2z4mc1, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
    automatically matched to 2AVY C:106-206
    protein/RNA complex; complexed with mg, par

Details for d2z4mc2

PDB Entry: 2z4m (more details), 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2z4mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z4mc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2z4mc2:

Click to download the PDB-style file with coordinates for d2z4mc2.
(The format of our PDB-style files is described here.)

Timeline for d2z4mc2: