SCOPe 2.08: Domain d2z4mc1: 2z4m C:1-105

Lineage for d2z4mc1 (2z4m C:1-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d2z4mc1: 2z4m C:1-105 [154106]
   Other proteins in same PDB: d2z4mb1, d2z4mc2, d2z4md1, d2z4me1, d2z4me2, d2z4mf1, d2z4mg1, d2z4mh1, d2z4mi1, d2z4mj1, d2z4mk1, d2z4ml1, d2z4mm1, d2z4mn1, d2z4mp1, d2z4mq1, d2z4mr1, d2z4ms1, d2z4mt1, d2z4mu1
   protein/RNA complex; complexed with mg, par
   protein/RNA complex; complexed with mg, par

Details for d2z4mc1

PDB Entry: 2z4m, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with paromomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2z4mc1:

Sequence; same for both SEQRES and ATOM records:

>d2z4mc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d2z4mc1:

• d2z4mc1 first appeared in SCOP 1.75
  
• d2z4mc1 appears in SCOPe 2.07