SCOPe 2.01: Domain d2z4lg1: 2z4l G:1-81

Lineage for d2z4lg1 (2z4l G:1-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2z4lg1: 2z4l G:1-81 [154082]
   Other proteins in same PDB: d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4l61, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lf1, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1
   automatically matched to 2AW4 G:1-81
   protein/RNA complex; complexed with mg, par, zn

Details for d2z4lg1

PDB Entry: 2z4l, 4.45 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with paromomycin and ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with paromomycin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2z4lg1:

Sequence; same for both SEQRES and ATOM records:

>d2z4lg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
srvakapvvvpagvdvkingqvitikgkngeltrtlndavevkhadntltfgprdgyadg
waqagtarallnsmvigvteg

Timeline for d2z4lg1:

• d2z4lg1 first appeared in SCOP 1.75
  
• d2z4lg1 appears in SCOPe 2.02
  
• d2z4lg1 appears in the current release, SCOPe 2.08