SCOPe 2.01: Domain d1t1na_: 1t1n A:

Lineage for d1t1na_ (1t1n A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (6 PDB entries)

8. Domain d1t1na_: 1t1n A: [15408]
   Other proteins in same PDB: d1t1nb_
   complexed with cmo, hem

Details for d1t1na_

PDB Entry: 1t1n, 2.2 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin

PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d1t1na_:

Sequence; same for both SEQRES and ATOM records:

>d1t1na_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1t1na_:

• d1t1na_ first appeared (with stable ids) in SCOP 1.55
  
• d1t1na_ appears in SCOP 1.75
  
• d1t1na_ appears in SCOPe 2.02
  
• d1t1na_ appears in the current release, SCOPe 2.08