Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (2 PDB entries) |
Domain d1t1na_: 1t1n A: [15408] Other proteins in same PDB: d1t1nb_ complexed with ace, cmo, hem |
PDB Entry: 1t1n (more details), 2.2 Å
SCOP Domain Sequences for d1t1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1na_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi)} slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d1t1na_: