SCOPe 2.01: Domain d1cg8a_: 1cg8 A:

Lineage for d1cg8a_ (1cg8 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46496] (2 PDB entries)

8. Domain d1cg8a_: 1cg8 A: [15407]
   Other proteins in same PDB: d1cg8b_
   complexed with cmo, hem

Details for d1cg8a_

PDB Entry: 1cg8, 1.9 Å

PDB Description: CO Form Hemoglobin from Dasyatis Akajei

PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d1cg8a_:

Sequence; same for both SEQRES and ATOM records:

>d1cg8a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}
vlssqnkkaieelgnlikanaeawgadalarlfelhpqtktyfskfsgfeacneqvkkhg
krvmnaladathhldnlhlhledlarkhgenllvdphnfhlfadcivvtlavnlqaftpv
thcavdkflelvayelsscyr

Timeline for d1cg8a_:

• d1cg8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cg8a_ appears in SCOP 1.75
  
• d1cg8a_ appears in SCOPe 2.02
  
• d1cg8a_ appears in the current release, SCOPe 2.08