Lineage for d1hbhc_ (1hbh C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436232Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (4 PDB entries)
  8. 436236Domain d1hbhc_: 1hbh C: [15405]
    Other proteins in same PDB: d1hbhb_, d1hbhd_

Details for d1hbhc_

PDB Entry: 1hbh (more details), 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbhc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii)}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOP Domain Coordinates for d1hbhc_:

Click to download the PDB-style file with coordinates for d1hbhc_.
(The format of our PDB-style files is described here.)

Timeline for d1hbhc_: